RAB33B monoclonal antibody (M01), clone 6F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB33B.
Immunogen
RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
RAB33B monoclonal antibody (M01), clone 6F4 Western Blot analysis of RAB33B expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB33B is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RAB33B
-
Interactome
-
Publication Reference
-
Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells.
Ishikawa T, Takizawa T, Iwaki J, Mishima T, Ui-Tei K, Takeshita T, Matsubara S, Takizawa T.
International Journal of Molecular Medicine 2015 May; 35(5):1273.
Application:WB-Ce, Human, HUVECs.
-
Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com