Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB33B polyclonal antibody (A01)

  • Catalog # : H00083452-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RAB33B.
  • Immunogen:
  • RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00083452-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • RAB33B polyclonal antibody (A01), Lot # MDC2051128QCS1 Western Blot analysis of RAB33B expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RAB33B
  • Gene Alias:
  • DKFZp434G099,MGC138182
  • Gene Description:
  • RAB33B, member RAS oncogene family
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook