Product Browser

Last updated: 2017/7/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCF7L1 polyclonal antibody (A01)

  • Catalog # : H00083439-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TCF7L1.
  • Immunogen:
  • TCF7L1 (NP_112573, 489 a.a. ~ 586 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00083439-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TCF7L1
  • Gene Alias:
  • TCF-3,TCF3
  • Gene Description:
  • transcription factor 7-like 1 (T-cell specific, HMG-box)
  • Gene Summary:
  • TCF/LEF transcription factors, such as TCF7L1, are mediators of the Wnt (see MIM 164820) signaling pathway and are antagonized by the TGF-beta (TGFB1; MIM 190180) signaling pathway (Sagara and Katoh, 2000 [PubMed 11085512]).[supplied by OMIM
  • Other Designations:
  • HMG-box transcription factor TCF-3
  • RSS
  • YouTube
  • Linkedin
  • Facebook