HYI purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HYI MaxPab rabbit polyclonal antibody. Western Blot analysis of HYI expression in mouse liver.
Western Blot (Tissue lysate)
HYI MaxPab rabbit polyclonal antibody. Western Blot analysis of HYI expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of HYI expression in transfected 293T cell line (H00081888-T02) by HYI MaxPab polyclonal antibody.
Lane 1: HYI transfected lysate(19.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HYI protein.
Immunogen
HYI (AAH19041.1, 1 a.a. ~ 174 a.a) full-length human protein.
Sequence
MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVG
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HYI MaxPab rabbit polyclonal antibody. Western Blot analysis of HYI expression in mouse liver.Western Blot (Tissue lysate)
HYI MaxPab rabbit polyclonal antibody. Western Blot analysis of HYI expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of HYI expression in transfected 293T cell line (H00081888-T02) by HYI MaxPab polyclonal antibody.
Lane 1: HYI transfected lysate(19.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HYI
Entrez GeneID
81888GeneBank Accession#
BC019041.2Protein Accession#
AAH19041.1Gene Name
HYI
Gene Alias
HT036, MGC20767
Gene Description
hydroxypyruvate isomerase homolog (E. coli)
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000008689|endothelial cell apoptosis protein E-CE1|hydroxypyruvate isomerase homolog
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com