RAB1B monoclonal antibody (M02), clone 1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAB1B monoclonal antibody (M02), clone 1B2. Western Blot analysis of RAB1B expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RAB1B expression in transfected 293T cell line by RAB1B monoclonal antibody (M02), clone 1B2.
Lane 1: RAB1B transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAB1B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB1B is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.95 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB1B.
Immunogen
RAB1B (NP_112243, 91 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB1B monoclonal antibody (M02), clone 1B2. Western Blot analysis of RAB1B expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB1B expression in transfected 293T cell line by RAB1B monoclonal antibody (M02), clone 1B2.
Lane 1: RAB1B transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAB1B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB1B is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — RAB1B
Entrez GeneID
81876GeneBank Accession#
NM_030981Protein Accession#
NP_112243Gene Name
RAB1B
Gene Alias
-
Gene Description
RAB1B, member RAS oncogene family
Gene Ontology
HyperlinkGene Summary
Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM
Other Designations
small GTP-binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com