SFXN3 monoclonal antibody (M01), clone 4A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SFXN3 monoclonal antibody (M01), clone 4A3. Western Blot analysis of SFXN3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of SFXN3 expression in transfected 293T cell line by SFXN3 monoclonal antibody (M01), clone 4A3.
Lane 1: SFXN3 transfected lysate (Predicted MW: 35.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFXN3 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SFXN3.
Immunogen
SFXN3 (AAH00124.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SFXN3 monoclonal antibody (M01), clone 4A3. Western Blot analysis of SFXN3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of SFXN3 expression in transfected 293T cell line by SFXN3 monoclonal antibody (M01), clone 4A3.
Lane 1: SFXN3 transfected lysate (Predicted MW: 35.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFXN3 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SFXN3
Entrez GeneID
81855GeneBank Accession#
BC000124Protein Accession#
AAH00124.2Gene Name
SFXN3
Gene Alias
BA108L7.2, SFX3
Gene Description
sideroflexin 3
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000059201
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com