Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NETO2 (Human) Recombinant Protein (P01)

  • Catalog # : H00081831-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NETO2 full-length ORF ( AAH12381.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00081831-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NETO2
  • Gene Alias:
  • FLJ10430,FLJ14724,FLJ90456,NEOT2
  • Gene Description:
  • neuropilin (NRP) and tolloid (TLL)-like 2
  • Gene Summary:
  • This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq
  • Other Designations:
  • neuropilin- and tolloid-like protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook