NETO2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NETO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NETO2 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of NETO2 expression in transfected 293T cell line (H00081831-T02) by NETO2 MaxPab polyclonal antibody.
Lane 1: NETO2 transfected lysate(17.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NETO2 protein.
Immunogen
NETO2 (AAH12381.1, 1 a.a. ~ 148 a.a) full-length human protein.
Sequence
MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NETO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NETO2 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of NETO2 expression in transfected 293T cell line (H00081831-T02) by NETO2 MaxPab polyclonal antibody.
Lane 1: NETO2 transfected lysate(17.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NETO2
Entrez GeneID
81831GeneBank Accession#
BC012381.1Protein Accession#
AAH12381.1Gene Name
NETO2
Gene Alias
FLJ10430, FLJ14724, FLJ90456, NEOT2
Gene Description
neuropilin (NRP) and tolloid (TLL)-like 2
Omim ID
607974Gene Ontology
HyperlinkGene Summary
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq
Other Designations
neuropilin- and tolloid-like protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com