Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NETO2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00081831-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NETO2 protein.
  • Immunogen:
  • NETO2 (AAH12381.1, 1 a.a. ~ 148 a.a) full-length human protein.
  • Sequence:
  • MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NETO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NETO2 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NETO2 expression in transfected 293T cell line (H00081831-T02) by NETO2 MaxPab polyclonal antibody.

    Lane 1: NETO2 transfected lysate(17.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NETO2
  • Gene Alias:
  • FLJ10430,FLJ14724,FLJ90456,NEOT2
  • Gene Description:
  • neuropilin (NRP) and tolloid (TLL)-like 2
  • Gene Summary:
  • This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq
  • Other Designations:
  • neuropilin- and tolloid-like protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook