MAP1LC3B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MAP1LC3B full-length ORF ( AAH18634, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
39.49
Interspecies Antigen Sequence
Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAP1LC3B
Entrez GeneID
81631GeneBank Accession#
BC018634Protein Accession#
AAH18634Gene Name
MAP1LC3B
Gene Alias
LC3B, MAP1A/1BLC3
Gene Description
microtubule-associated protein 1 light chain 3 beta
Gene Ontology
HyperlinkGene Summary
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq
Other Designations
microtubule-associated proteins 1A/1B light chain 3
-
Interactome
-
Publication Reference
-
Prospective neoadjuvant analysis of PET imaging and mechanisms of resistance to Trastuzumab shows role of HIF1 and autophagy.
Koukourakis MI, Giatromanolaki A, Bottini A, Cappelletti MR, Zanotti L, Allevi G, Strina C, Ardine M, Milani M, Brugnoli G, Martinotti M, Ferrero G, Bertoni R, Ferrozzi F, Harris AL, Generali D.
British Journal of Cancer 2014 Apr; 110(9):2209.
Application：IHC-P, Human, Breast cancer.
-
LC3 immunostaining pitfalls.
Koukourakis MI, Giatromanolaki A, Zois CE, Sivridis E.
Histopathology 2013 May; 62(6):962.
Application：WB, Antibody.
-
Immunohistochemical analysis of macroautophagy: recommendations and limitations.
Martinet W, Schrijvers DM, Timmermans JP, Bult H, De Meyer GR.
Autophagy 2013 Mar; 9(3):386.
Application：WB-Re, Antibody testing.
-
Prospective neoadjuvant analysis of PET imaging and mechanisms of resistance to Trastuzumab shows role of HIF1 and autophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com