MAP1LC3B monoclonal antibody (M02), clone 4G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MAP1LC3B.
Immunogen
MAP1LC3B (AAH18634, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.49 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP1LC3B is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MAP1LC3B
Entrez GeneID
81631GeneBank Accession#
BC018634Protein Accession#
AAH18634Gene Name
MAP1LC3B
Gene Alias
LC3B, MAP1A/1BLC3
Gene Description
microtubule-associated protein 1 light chain 3 beta
Gene Ontology
HyperlinkGene Summary
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq
Other Designations
microtubule-associated proteins 1A/1B light chain 3
-
Interactome
-
Publication Reference
-
Bacteroides fragilis Enterotoxin Induces the Formation of Autophagosomes in Endothelial Cells but Interferes Their Autophagosomal Fusion with Lysosomes for Complete Autophagic Flux Through a Mitogen-Activated Protein Kinase, AP-1, and C/EBP Homologous Protein-Dependent Pathway.
Ko SH, Jeon JI, Myung HS, Kim YJ, Kim JM.
Infection and Immunity 2017 Sep; 85(10):e00420-17.
Application:IF, Human, CRL1730 cells, HUVEC.
-
Bacteroides fragilis Enterotoxin Induces the Formation of Autophagosomes in Endothelial Cells but Interferes Their Autophagosomal Fusion with Lysosomes for Complete Autophagic Flux Through a Mitogen-Activated Protein Kinase, AP-1, and C/EBP Homologous Protein-Dependent Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com