TSSK3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TSSK3 partial ORF ( AAH35354, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TSSK3
Entrez GeneID
81629GeneBank Accession#
BC035354Protein Accession#
AAH35354Gene Name
TSSK3
Gene Alias
SPOGA3, STK22C, STK22D
Gene Description
testis-specific serine kinase 3
Omim ID
607660Gene Ontology
HyperlinkGene Summary
This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function. [provided by RefSeq
Other Designations
OTTHUMP00000008862|serine/threonine kinase 22C (spermiogenesis associated)|spermiogenesis associated 3|testis-specific serine/threonine kinase 22C
-
Interactome
-
Publication Reference
-
Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.
Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM.
Mol Hum Reprod 2010 Aug; 17:42.
Application:Con, Human, Mouse, Human sperm, Mouse sperm.
-
Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com