TSC22D4 monoclonal antibody (M07), clone 4G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TSC22D4.
Immunogen
TSC22D4 (AAH01966, 1 a.a. ~ 395 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (68.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TSC22D4 monoclonal antibody (M07), clone 4G7 Western Blot analysis of TSC22D4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TSC22D4 monoclonal antibody (M07), clone 4G7. Western Blot analysis of TSC22D4 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSC22D4 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TSC22D4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TSC22D4
Entrez GeneID
81628GeneBank Accession#
BC001966Protein Accession#
AAH01966Gene Name
TSC22D4
Gene Alias
THG-1, THG1
Gene Description
TSC22 domain family, member 4
Gene Ontology
HyperlinkGene Summary
TSC22D4 is a member of the TSC22 domain family of leucine zipper transcriptional regulators (see TSC22D3; MIM 300506) (Kester et al., 1999 [PubMed 10488076]; Fiorenza et al., 2001 [PubMed 11707329]).[supplied by OMIM
Other Designations
TSC-22-like|TSC22 domain family 4
-
Interactome
-
Publication Reference
-
Promotion of squamous cell carcinoma tumorigenesis by oncogene-mediated THG-1/TSC22D4 phosphorylation.
Nohara Goto, Hiroyuki Suzuki, Ling Zheng, Yasuhito Okano, Yukari Okita, Yukihide Watanabe, Yukinari Kato, Mitsuyasu Kato.
Cancer Science 2023 Oct; 114(10):3972.
Application:IHC-P, IF, WB, Human, Mouse, Cervix, esophagus, hair, lung, skin, gastric (squamous cell carcinomas, SCCs),HaCaT, HEK293T, P3U1, TE13 cells.
-
Promotion of cellular senescence by THG-1/TSC22D4 knockout through activation of JUNB.
Zhang X, Koga N, Suzuki H, Kato M.
Biochemical and Biophysical Research Communications 2020 Feb; 522(4):897.
Application:WB, Human, TE13 cells.
-
Promotion of squamous cell carcinoma tumorigenesis by oncogene-mediated THG-1/TSC22D4 phosphorylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com