PVRL4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PVRL4 partial ORF ( NP_112178, 31 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PVRL4
Entrez GeneID
81607GeneBank Accession#
NM_030916Protein Accession#
NP_112178Gene Name
PVRL4
Gene Alias
LNIR, PRR4, nectin-4
Gene Description
poliovirus receptor-related 4
Omim ID
609607Gene Ontology
HyperlinkGene Summary
Poliovirus receptor-like proteins (PVRLs), such as PVRL4, are adhesion receptors of the immunoglobulin superfamily and function in cell-cell adhesion (Reymond et al., 2001 [PubMed 11544254]).[supplied by OMIM
Other Designations
Ig superfamily receptor LNIR|OTTHUMP00000029698|nectin 4
-
Interactome
-
Pathway
-
Publication Reference
-
Potential role for nectin-4 in the pathogenesis of pre-eclampsia: a molecular genetic study.
Ito M, Nishizawa H, Tsutsumi M, Kato A, Sakabe Y, Noda Y, Ohwaki A, Miyazaki J, Kato T, Shiogama K, Sekiya T, Kurahashi H, Fujii T.
BMC Medical Genetics 2018 Sep; 19(1):166.
Application:IS, WB-Ti, Human, Placental.
-
Potential role for nectin-4 in the pathogenesis of pre-eclampsia: a molecular genetic study.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com