Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL21A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00081578-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COL21A1 partial ORF ( NP_110447, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00081578-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • COL21A1
  • Gene Alias:
  • COLA1L,DKFZp564B052,FLJ39125,FLJ44623,FP633,MGC26619,dJ682J15.1,dJ708F5.1
  • Gene Description:
  • collagen, type XXI, alpha 1
  • Gene Summary:
  • This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000040019,alpha 1 chain-like collagen
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook