Product Browser

Last updated: 2017/3/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL21A1 polyclonal antibody (A01)

  • Catalog # : H00081578-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant COL21A1.
  • Immunogen:
  • COL21A1 (NP_110447, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00081578-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • COL21A1
  • Gene Alias:
  • COLA1L,DKFZp564B052,FLJ39125,FLJ44623,FP633,MGC26619,dJ682J15.1,dJ708F5.1
  • Gene Description:
  • collagen, type XXI, alpha 1
  • Gene Summary:
  • This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000040019,alpha 1 chain-like collagen
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook