HM13 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HM13 full-length ORF ( NP_848697.1, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.80
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HM13
Entrez GeneID
81502GeneBank Accession#
NM_178582.1Protein Accession#
NP_848697.1Gene Name
HM13
Gene Alias
H13, IMP1, IMPAS, MSTP086, PSENL3, PSL3, SPP, dJ324O17.1
Gene Description
histocompatibility (minor) 13
Omim ID
607106Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030527|OTTHUMP00000030528|intramembrane protease|minor histocompatibility antigen 13|presenilin-like protein 3|signal peptide peptidase beta
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com