Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COLEC12 polyclonal antibody (A01)

  • Catalog # : H00081035-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant COLEC12.
  • Immunogen:
  • COLEC12 (AAH60789, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • COLEC12 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of COLEC12 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • COLEC12
  • Gene Alias:
  • CLP1,NSR2,SCARA4,SRCL
  • Gene Description:
  • collectin sub-family member 12
  • Gene Summary:
  • This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells. [provided by RefSeq
  • Other Designations:
  • collectin placenta 1,nurse cell scavenger receptor 2,scavenger receptor class A, member 4,scavenger receptor with C-type lectin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook