Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNH6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00081033-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNH6 partial ORF ( NP_110406.1, 31 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IANAQMENCAIIYCNDGFCELFGYSRVEVMQQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.54
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00081033-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • KCNH6
  • Gene Alias:
  • ERG2,HERG2,Kv11.2
  • Gene Description:
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq
  • Other Designations:
  • eag related protein 2,eag-related gene member 2,ether-a-go-go related gene potassium channel 2,potassium voltage-gated channel, subfamily H, member 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook