ZBP1 monoclonal antibody (M01), clone 2C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZBP1 expression in transfected 293T cell line by ZBP1 monoclonal antibody (M01), clone 2C10.
Lane 1: ZBP1 transfected lysate (Predicted MW: 16 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBP1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ZBP1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZBP1.
Immunogen
ZBP1 (NP_110403.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (56)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZBP1 expression in transfected 293T cell line by ZBP1 monoclonal antibody (M01), clone 2C10.
Lane 1: ZBP1 transfected lysate (Predicted MW: 16 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBP1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ZBP1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ZBP1
Entrez GeneID
81030GeneBank Accession#
NM_030776Protein Accession#
NP_110403.1Gene Name
ZBP1
Gene Alias
C20orf183, DAI, DLM-1, DLM1
Gene Description
Z-DNA binding protein 1
Omim ID
606750Gene Ontology
HyperlinkGene Summary
DLM1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.[supplied by OMIM
Other Designations
OTTHUMP00000031373|tumor stroma and activated macrophage protein DLM-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com