Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TUBB1 (Human) Recombinant Protein (P01)

  • Catalog # : H00081027-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TUBB1 full-length ORF ( NP_110400.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 76.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00081027-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TUBB1
  • Gene Alias:
  • dJ543J19.4
  • Gene Description:
  • tubulin, beta 1
  • Gene Summary:
  • Microtubules are involved in a wide variety of cellular processes, including mitosis, morphogenesis, platelet formation, and mobility of cilia and flagella. Circulating platelets carry a single marginal microtubule coil that is wound in 8 to 12 turns and is responsible for platelet shape. TUBB1 is the major beta-tubulin expressed in platelets and megakaryocytes and is required for optimal platelet assembly (Wang et al., 1986 [PubMed 3782288]; Schulze et al., 2004 [PubMed 15315966]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000031411,beta tubulin 1, class VI
  • RSS
  • YouTube
  • Linkedin
  • Facebook