TUBB1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TUBB1 protein.
Immunogen
TUBB1 (NP_110400.1, 1 a.a. ~ 451 a.a) full-length human protein.
Sequence
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TUBB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TUBB1 expression in mouse lung.Western Blot (Tissue lysate)
TUBB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TUBB1 expression in human liver.Western Blot (Cell lysate)
TUBB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TUBB1 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of TUBB1 expression in transfected 293T cell line (H00081027-T02) by TUBB1 MaxPab polyclonal antibody.
Lane 1: TUBB1 transfected lysate(50.30 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TUBB1 transfected lysate using anti-TUBB1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TUBB1 purified MaxPab mouse polyclonal antibody (B01P) (H00081027-B01P). -
Gene Info — TUBB1
Entrez GeneID
81027GeneBank Accession#
NM_030773Protein Accession#
NP_110400.1Gene Name
TUBB1
Gene Alias
dJ543J19.4
Gene Description
tubulin, beta 1
Gene Ontology
HyperlinkGene Summary
Microtubules are involved in a wide variety of cellular processes, including mitosis, morphogenesis, platelet formation, and mobility of cilia and flagella. Circulating platelets carry a single marginal microtubule coil that is wound in 8 to 12 turns and is responsible for platelet shape. TUBB1 is the major beta-tubulin expressed in platelets and megakaryocytes and is required for optimal platelet assembly (Wang et al., 1986 [PubMed 3782288]; Schulze et al., 2004 [PubMed 15315966]).[supplied by OMIM
Other Designations
OTTHUMP00000031411|beta tubulin 1, class VI
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com