TMPRSS5 monoclonal antibody (M09), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TMPRSS5 monoclonal antibody (M09), clone 2E5. Western Blot analysis of TMPRSS5 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of TMPRSS5 expression in transfected 293T cell line by TMPRSS5 monoclonal antibody (M09), clone 2E5.
Lane 1: TMPRSS5 transfected lysate (Predicted MW: 49.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TMPRSS5 is 3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.
Immunogen
TMPRSS5 (NP_110397.1, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (80)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TMPRSS5 monoclonal antibody (M09), clone 2E5. Western Blot analysis of TMPRSS5 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of TMPRSS5 expression in transfected 293T cell line by TMPRSS5 monoclonal antibody (M09), clone 2E5.
Lane 1: TMPRSS5 transfected lysate (Predicted MW: 49.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TMPRSS5 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — TMPRSS5
Entrez GeneID
80975GeneBank Accession#
NM_030770Protein Accession#
NP_110397.1Gene Name
TMPRSS5
Gene Alias
MGC141886, MGC148044, SPINESIN
Gene Description
transmembrane protease, serine 5
Omim ID
606751Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the serine protease family. Serine proteases are known to be involved in many physiological and pathological processes. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com