Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SET7 polyclonal antibody (A01)

  • Catalog # : H00080854-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SET7.
  • Immunogen:
  • SET7 (NP_085151, 257 a.a. ~ 366 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080854-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SET7 polyclonal antibody (A01), Lot # 051212JC01. Western Blot analysis of SET7 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SET7 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of SET7 expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SETD7
  • Gene Alias:
  • FLJ21193,KIAA1717,KMT7,SET7,SET7/9,SET9
  • Gene Description:
  • SET domain containing (lysine methyltransferase) 7
  • Other Designations:
  • H3-K4-HMTase,SET domain-containing protein 7,histone H3-K4 methyltransferase,histone H3-lysine 4-specific methyltransferase
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook