TAS1R1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TAS1R1 partial ORF ( NP_619642, 281 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RVFFESVVLTNLTGKVWVASEAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (68); Rat (68)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TAS1R1
Entrez GeneID
80835GeneBank Accession#
NM_138697Protein Accession#
NP_619642Gene Name
TAS1R1
Gene Alias
GPR70, T1R1, TR1, gm148
Gene Description
taste receptor, type 1, member 1
Omim ID
606225Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
G protein-coupled receptor 70|OTTHUMP00000001581|sweet taste receptor T1r
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Development of sensitive and stable electrochemical impedimetric biosensor based on T1R1 receptor and its application to detection of umami substances.
Yijian Wang, Liqin Kong, Guoqiang Shu, Guanqquan Sun, Yaoze Feng, Ming Zhu.
Food Chemistry 2023 Oct; 423:136233.
Application：Sub, Recombinant proteins.
-
Development of sensitive and stable electrochemical impedimetric biosensor based on T1R1 receptor and its application to detection of umami substances.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com