Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOL4 (Human) Recombinant Protein (P01)

  • Catalog # : H00080832-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APOL4 full-length ORF ( ENSP00000331089, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00080832-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • APOL4
  • Gene Alias:
  • APOL-IV,APOLIV
  • Gene Description:
  • apolipoprotein L, 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028937,apolipoprotein L-IV,apolipoprotein L4
  • RSS
  • YouTube
  • Linkedin
  • Facebook