Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOL4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00080832-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human APOL4 protein.
  • Immunogen:
  • APOL4 (ENSP00000331089, 1 a.a. ~ 107 a.a) full-length human protein.
  • Sequence:
  • MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of APOL4 expression in transfected 293T cell line (H00080832-T02) by APOL4 MaxPab polyclonal antibody.

    Lane 1: APOL4 transfected lysate(11.77 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • APOL4
  • Gene Alias:
  • APOL-IV,APOLIV
  • Gene Description:
  • apolipoprotein L, 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028937,apolipoprotein L-IV,apolipoprotein L4
  • RSS
  • YouTube
  • Linkedin
  • Facebook