CYB5B purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CYB5-M MaxPab polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.
Western Blot (Cell lysate)
CYB5B MaxPab polyclonal antibody. Western Blot analysis of CYB5B expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of CYB5B expression in transfected 293T cell line (H00080777-T02) by CYB5B MaxPab polyclonal antibody.
Lane 1: CYB5-M transfected lysate(16.06 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CYB5B protein.
Immunogen
CYB5B (AAH04373.1, 1 a.a. ~ 146 a.a) full-length human protein.
Sequence
MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (74)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CYB5-M MaxPab polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.Western Blot (Cell lysate)
CYB5B MaxPab polyclonal antibody. Western Blot analysis of CYB5B expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of CYB5B expression in transfected 293T cell line (H00080777-T02) by CYB5B MaxPab polyclonal antibody.
Lane 1: CYB5-M transfected lysate(16.06 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYB5B
Entrez GeneID
80777GeneBank Accession#
BC004373Protein Accession#
AAH04373.1Gene Name
CYB5B
Gene Alias
CYB5-M, CYPB5M, DKFZp686M0619, OMB5
Gene Description
cytochrome b5 type B (outer mitochondrial membrane)
Gene Ontology
HyperlinkOther Designations
cytochrome b5 outer mitochondrial membrane|outer mitochondrial membrane cytochrome b5|type 2 cyt-b5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com