STARD5 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of STARD5 expression in transfected 293T cell line (H00080765-T02) by STARD5 MaxPab polyclonal antibody.
Lane 1: STARD5 transfected lysate(23.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human STARD5 protein.
Immunogen
STARD5 (NP_871629.1, 1 a.a. ~ 213 a.a) full-length human protein.
Sequence
MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of STARD5 expression in transfected 293T cell line (H00080765-T02) by STARD5 MaxPab polyclonal antibody.
Lane 1: STARD5 transfected lysate(23.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — STARD5
Entrez GeneID
80765GeneBank Accession#
NM_181900.2Protein Accession#
NP_871629.1Gene Name
STARD5
Gene Alias
MGC10327
Gene Description
StAR-related lipid transfer (START) domain containing 5
Omim ID
607050Gene Ontology
HyperlinkGene Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD5 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM
Other Designations
START domain containing 5|StAR-related lipid transfer protein 5
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com