Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C6orf25 (Human) Recombinant Protein (P01)

  • Catalog # : H00080739-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C6orf25 full-length ORF ( NP_079536.2, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00080739-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • C6orf25
  • Gene Alias:
  • G6b,MGC142279,MGC142281,NG31
  • Gene Description:
  • chromosome 6 open reading frame 25
  • Gene Summary:
  • This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • G6B protein,OTTHUMP00000029171,OTTHUMP00000029172,OTTHUMP00000029173,OTTHUMP00000029176,OTTHUMP00000029177,OTTHUMP00000062679,immunoglobulin receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook