C6orf25 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human C6orf25 full-length ORF ( NP_079536.2, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.4
Interspecies Antigen Sequence
Mouse (73); Rat (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — C6orf25
Entrez GeneID
80739GeneBank Accession#
NM_025260.2Protein Accession#
NP_079536.2Gene Name
C6orf25
Gene Alias
G6b, MGC142279, MGC142281, NG31
Gene Description
chromosome 6 open reading frame 25
Omim ID
606520Gene Ontology
HyperlinkGene Summary
This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
G6B protein|OTTHUMP00000029171|OTTHUMP00000029172|OTTHUMP00000029173|OTTHUMP00000029176|OTTHUMP00000029177|OTTHUMP00000062679|immunoglobulin receptor
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com