C6orf25 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C6orf25 expression in transfected 293T cell line (H00080739-T01) by C6orf25 MaxPab polyclonal antibody.
Lane1:C6orf25 transfected lysate(26.07 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C6orf25 protein.
Immunogen
C6orf25 (NP_079536.2, 1 a.a. ~ 237 a.a) full-length human protein.
Sequence
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C6orf25 expression in transfected 293T cell line (H00080739-T01) by C6orf25 MaxPab polyclonal antibody.
Lane1:C6orf25 transfected lysate(26.07 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — C6orf25
Entrez GeneID
80739GeneBank Accession#
NM_025260.2Protein Accession#
NP_079536.2Gene Name
C6orf25
Gene Alias
G6b, MGC142279, MGC142281, NG31
Gene Description
chromosome 6 open reading frame 25
Omim ID
606520Gene Ontology
HyperlinkGene Summary
This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
G6B protein|OTTHUMP00000029171|OTTHUMP00000029172|OTTHUMP00000029173|OTTHUMP00000029176|OTTHUMP00000029177|OTTHUMP00000062679|immunoglobulin receptor
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com