Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDCD1LG2 monoclonal antibody (M46), clone 4G7

  • Catalog # : H00080380-M46
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
  • Immunogen:
  • PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080380-M46
    Western Blot detection against Immunogen (13.53 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PDCD1LG2 monoclonal antibody (M46), clone 4G7. Western Blot analysis of PDCD1LG2 expression in human pancreas.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PDCD1LG2
  • Gene Alias:
  • B7DC,Btdc,CD273,MGC142238,MGC142240,PD-L2,PDCD1L2,PDL2,bA574F11.2
  • Gene Description:
  • programmed cell death 1 ligand 2
  • Other Designations:
  • OTTHUMP00000021030,PD-1-ligand 2,programmed death ligand 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook