Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LPAL2 (Human) Recombinant Protein (P01)

  • Catalog # : H00080350-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LPAL2 full-length ORF ( AAI66644.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 14.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LPAL2
  • Gene Alias:
  • APOA2,APOAL,APOARGC,MGC129532,RP11-72O9.2
  • Gene Description:
  • lipoprotein, Lp(a)-like 2
  • Gene Summary:
  • Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this gene contain a truncated open reading frame and are candidates for nonsense-mediated decay. Consequently, this gene is considered to be a pseudogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • apolipoprotein (a) related gene C,apolipoprotein A-II,apolipoprotein A-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook