ADAM33 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ADAM33 full-length ORF ( AAH62663.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.8
Interspecies Antigen Sequence
Mouse (58)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ADAM33
Entrez GeneID
80332GeneBank Accession#
BC062663.1Protein Accession#
AAH62663.1Gene Name
ADAM33
Gene Alias
C20orf153, DJ964F7.1, DKFZp434K0521, FLJ35308, FLJ36751, MGC149823, MGC71889
Gene Description
ADAM metallopeptidase domain 33
Omim ID
607114Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000030126|a disintegrin and metalloprotease 33|a disintegrin and metalloproteinase domain 33|disintegrin and reprolysin metalloproteinase family protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com