Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ULBP2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00080328-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ULBP2 protein.
  • Immunogen:
  • ULBP2 (AAH34689, 1 a.a. ~ 246 a.a) full-length human protein.
  • Sequence:
  • MEAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Flow Cytometry
  • Flow Cytometry enlargeenlarge this image
  • FACS analysis of negative control 293 cells (Black) and ULBP2 expressing 293 cells (Green) using ULBP2 purified MaxPab mouse polyclonal antibody.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ULBP2 MaxPab polyclonal antibody. Western Blot analysis of ULBP2 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ULBP2 expression in transfected 293T cell line (H00080328-T01) by ULBP2 MaxPab polyclonal antibody.

    Lane 1: ULBP2 transfected lysate(27.17 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ULBP2
  • Gene Alias:
  • N2DL2,RAET1H
  • Gene Description:
  • UL16 binding protein 2
  • Other Designations:
  • ALCAN-alpha,NKG2D ligand 2,OTTHUMP00000017408,UL16-binding protein 2,retinoic acid early transcript 1 H
  • RSS
  • YouTube
  • Linkedin
  • Facebook