GKAP1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GKAP1 polyclonal antibody (A01), Lot # 060613JCS1. Western Blot analysis of GKAP1 expression in human ovarian cancer.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GKAP1.
Immunogen
GKAP1 (NP_079487, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Sequence
AENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GKAP1 polyclonal antibody (A01), Lot # 060613JCS1. Western Blot analysis of GKAP1 expression in human ovarian cancer.Western Blot (Recombinant protein)
ELISA
-
Gene Info — GKAP1
Entrez GeneID
80318GeneBank Accession#
NM_025211Protein Accession#
NP_079487Gene Name
GKAP1
Gene Alias
FKSG21, FLJ25469, GKAP42
Gene Description
G kinase anchoring protein 1
Omim ID
611356Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cGMP-dependent protein kinase anchoring protein 42kDa|protein kinase anchoring protein GKAP42
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com