TET1 monoclonal antibody (M01), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TET1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TET1.
Immunogen
TET1 (NP_085128.1, 2038 a.a. ~ 2136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TET1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — TET1
Entrez GeneID
80312GeneBank Accession#
NM_030625Protein Accession#
NP_085128.1Gene Name
TET1
Gene Alias
CXXC6, FLJ10839, FLJ41442, KIAA1676, LCX, bA119F7.1
Gene Description
tet oncogene 1
Omim ID
607790Gene Ontology
HyperlinkOther Designations
CXXC finger 6|OTTHUMP00000019708|OTTHUMP00000060749|leukemia-associated protein with a CXXC domain|ten-eleven translocation-1
-
Disease
-
Publication Reference
-
Hyperglycemia and O-GlcNAc transferase activity drive a cancer stem cell pathway in triple-negative breast cancer.
Saheed A Ayodeji, Bin Bao, Emily A Teslow, Lisa A Polin, Greg Dyson, Aliccia Bollig-Fischer, Charlie Fehl.
Cancer Cell International 2023 May; 23(1):102.
Application：WB-Ce, Human, MDA-MB231 cells.
-
Hyperglycemia and O-GlcNAc transferase activity drive a cancer stem cell pathway in triple-negative breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com