EFHD1 monoclonal antibody (M05), clone 1H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EFHD1.
Immunogen
EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (82); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EFHD1 monoclonal antibody (M05), clone 1H7 Western Blot analysis of EFHD1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
EFHD1 monoclonal antibody (M05), clone 1H7. Western Blot analysis of EFHD1 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EFHD1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EFHD1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — EFHD1
Entrez GeneID
80303GeneBank Accession#
NM_025202Protein Accession#
NP_079478.1Gene Name
EFHD1
Gene Alias
DKFZp781H0842, FLJ13612, MST133, MSTP133, PP3051
Gene Description
EF-hand domain family, member D1
Omim ID
611617Gene Ontology
HyperlinkGene Summary
EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM
Other Designations
EF hand domain containing 1|EF hand domain family, member D1
-
Interactome
-
Publication Reference
-
Distinct functional properties of murine perinatal and adult adipose progenitor subpopulations.
Qianbin Zhang, Bo Shan, Lei Guo, Mengle Shao, Lavanya Vishvanath, George Elmquist, Lin Xu, Rana K Gupta.
Nature Metabolism 2022 Aug; 4(8):1055.
Application:IF, Mouse, Mouse epididymal white adipose tissue.
-
Distinct functional properties of murine perinatal and adult adipose progenitor subpopulations.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com