Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD3B7 (Human) Recombinant Protein (Q01)

  • Catalog # : H00080270-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSD3B7 partial ORF ( NP_079469, 101 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00080270-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HSD3B7
  • Gene Alias:
  • PFIC4,SDR11E3
  • Gene Description:
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
  • Gene Summary:
  • This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase,3 beta-hydroxysteroid dehydrogenase type VII,3-beta-HSD VII,C(27)-3BETA-HSD,short chain dehydrogenase/reductase family 11E, member 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook