Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD3B7 polyclonal antibody (A01)

  • Catalog # : H00080270-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSD3B7.
  • Immunogen:
  • HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080270-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HSD3B7
  • Gene Alias:
  • PFIC4,SDR11E3
  • Gene Description:
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
  • Gene Summary:
  • This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase,3 beta-hydroxysteroid dehydrogenase type VII,3-beta-HSD VII,C(27)-3BETA-HSD,short chain dehydrogenase/reductase family 11E, member 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook