ELL3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ELL3 protein.
Immunogen
ELL3 (AAH19293, 1 a.a. ~ 397 a.a) full-length human protein.
Sequence
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ELL3 expression in transfected 293T cell line (H00080237-T01) by ELL3 MaxPab polyclonal antibody.
Lane 1: ELL3 transfected lysate(43.78 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ELL3
-
Interactome
-
Publication Reference
-
Selective expression of the transcription elongation factor ELL3 in B cells prior to ELL2 drives proliferation and survival.
Alexander LMM, Watters J, Reusch JA, Maurin M, Nepon-Sixt BS, Vrzalikova K, Alexandrow MG, Murray PG, Wright KL.
Molecular Immunology 2017 Aug; 91:8.
Application:WB-Ce, WB-Tr, Human, CA46, HEK 293T, NCI-H929, Raji, U266 cells, Human primary plasmablasts.
-
Ribavirin-induced intracellular GTP depletion activates transcription elongation in coagulation factor VII gene expression.
Suzuki A, Miyawaki Y, Okuyama E, Murata M, Ando Y, Kato I, Takagi Y, Takagi A, Murate T, Saito H, Kojima T.
The Biochemical Journal 2013 Jan; 449(1):231.
Application:WB-Ce, WB-Tr, Human, HepG2 cells.
-
Selective expression of the transcription elongation factor ELL3 in B cells prior to ELL2 drives proliferation and survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com