ALPK1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ALPK1 partial ORF ( NP_079420.2, 1147 a.a. - 1242 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (66); Rat (66)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ALPK1
Entrez GeneID
80216GeneBank Accession#
NM_025144Protein Accession#
NP_079420.2Gene Name
ALPK1
Gene Alias
8430410J10Rik, FLJ22670, KIAA1527, LAK
Gene Description
alpha-kinase 1
Omim ID
607347Gene Ontology
HyperlinkGene Summary
Unlike most eukaryotic kinases, alpha kinases, such as LAK, recognize phosphorylation sites in which the surrounding peptides have an alpha-helical conformation.[supplied by OMIM
Other Designations
chromosome 4 kinase|lymphocyte alpha-kinase
-
Interactome
-
Disease
-
Publication Reference
-
Pyroptosis of chondrocytes activated by synovial inflammation accelerates TMJ osteoarthritis cartilage degeneration via ROS/NLRP3 signaling.
Xin Liu, Yanyan Li, Jie Zhao, Zhihui Hu, Wei Fang, Jin Ke, Wei Li, Xing Long.
International Immunopharmacology 2023 Aug; 124(Pt A):110781.
Application:Stimulation, Mouse, Raw 264.7 cells.
-
ALPK1 Expressed in IB4-Positive Neurons of Mice Trigeminal Ganglions Promotes MIA-Induced TMJ pain.
Taomin Zhu, Huimin Li, Yuxiang Chen, Xueke Jia, Xiaohan Ma, Xin Liu, Yaping Feng, Jin Ke
Molecular Neurobiology 2023 Nov; 60(11):6264.
Application:Stimulation, Mouse, Mouse trigeminal ganglions.
-
ALPK1 Accelerates the Pathogenesis of Osteoarthritis by Activating NLRP3 Signaling.
Xin Liu, Jie Zhao, Henghua Jiang, Huilin Guo, Yingjie Li, Huimin Li, Yaping Feng, Jin Ke, Xing Long.
Journal of Bone and Mineral Research 2022 Oct; 37(10):1973.
Application:Func, Mouse, ATDC5 cells, mouse knee joint.
-
ALPK1 Aggravates TMJOA Cartilage Degradation via NF-κB and ERK1/2 Signaling.
X Liu, J Zhao, H Jiang, H Li, Y Feng, J Ke, X Long.
Journal of Dental Research 2022 Nov; 101(12):1499.
Application:Cell culture, Mouse, ATDC5 cells.
-
Pyroptosis of chondrocytes activated by synovial inflammation accelerates TMJ osteoarthritis cartilage degeneration via ROS/NLRP3 signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com