Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OPA3 monoclonal antibody (M03A), clone 1B8

  • Catalog # : H00080207-M03A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant OPA3.
  • Immunogen:
  • OPA3 (NP_079412.1, 103 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQTQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080207-M03A
    Western Blot detection against Immunogen (34.21 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • OPA3
  • Gene Alias:
  • FLJ22187,FLJ25932,MGA3,MGC75494
  • Gene Description:
  • optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
  • Other Designations:
  • OPA3 protein,Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus')
  • RSS
  • YouTube
  • Linkedin
  • Facebook