FBXO11 monoclonal antibody (M02), clone 1A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXO11.
Immunogen
FBXO11 (NP_079409, 744 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBXO11 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FBXO11 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FBXO11
Entrez GeneID
80204GeneBank Accession#
NM_025133Protein Accession#
NP_079409Gene Name
FBXO11
Gene Alias
FBX11, FLJ12673, MGC44383, PRMT9, UBR6, UG063H01, VIT1
Gene Description
F-box protein 11
Omim ID
607871Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
F-box only protein 11|ubiquitin protein ligase E3 component n-recognin 6|vitiligo-associated protein VIT-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com