Cep290 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human Cep290 full-length ORF ( AAH08641.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.6
Interspecies Antigen Sequence
Mouse (92); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CEP290
Entrez GeneID
80184GeneBank Accession#
BC008641.1Protein Accession#
AAH08641.1Gene Name
CEP290
Gene Alias
3H11Ag, BBS14, FLJ13615, FLJ21979, JBTS5, JBTS6, KIAA0373, LCA10, MKS4, NPHP6, SLSN6, rd16
Gene Description
centrosomal protein 290kDa
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq
Other Designations
CTCL tumor antigen se2-2|monoclonal antibody 3H11 antigen|nephrocytsin-6|prostate cancer antigen T21
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com