DRF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DRF1 partial ORF ( NP_663696, 201 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DBF4B
Entrez GeneID
80174GeneBank Accession#
NM_145663Protein Accession#
NP_663696Gene Name
DBF4B
Gene Alias
ASKL1, DRF1, FLJ13087, MGC15009, ZDBF1B, chifb
Gene Description
DBF4 homolog B (S. cerevisiae)
Omim ID
611661Gene Ontology
HyperlinkGene Summary
This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq
Other Designations
DBF4 homolog B|Dbf4-related factor 1|activator of S-phase kinase-like protein 1|chiffon homolog B|zinc finger, DBF-type containing 1B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com