Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DRF1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00080174-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DRF1 protein.
  • Immunogen:
  • DRF1 (NP_079380.1, 1 a.a. ~ 170 a.a) full-length human protein.
  • Sequence:
  • MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DBF4B expression in transfected 293T cell line (H00080174-T01) by DBF4B MaxPab polyclonal antibody.

    Lane 1: DRF1 transfected lysate(18.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DBF4B
  • Gene Alias:
  • ASKL1,DRF1,FLJ13087,MGC15009,ZDBF1B,chifb
  • Gene Description:
  • DBF4 homolog B (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • DBF4 homolog B,Dbf4-related factor 1,activator of S-phase kinase-like protein 1,chiffon homolog B,zinc finger, DBF-type containing 1B
  • RSS
  • YouTube
  • Linkedin
  • Facebook