DRF1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DBF4B expression in transfected 293T cell line (H00080174-T01) by DBF4B MaxPab polyclonal antibody.
Lane 1: DRF1 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DRF1 protein.
Immunogen
DRF1 (NP_079380.1, 1 a.a. ~ 170 a.a) full-length human protein.
Sequence
MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DBF4B expression in transfected 293T cell line (H00080174-T01) by DBF4B MaxPab polyclonal antibody.
Lane 1: DRF1 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DBF4B
Entrez GeneID
80174GeneBank Accession#
NM_025104.2Protein Accession#
NP_079380.1Gene Name
DBF4B
Gene Alias
ASKL1, DRF1, FLJ13087, MGC15009, ZDBF1B, chifb
Gene Description
DBF4 homolog B (S. cerevisiae)
Omim ID
611661Gene Ontology
HyperlinkGene Summary
This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq
Other Designations
DBF4 homolog B|Dbf4-related factor 1|activator of S-phase kinase-like protein 1|chiffon homolog B|zinc finger, DBF-type containing 1B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com