YSK4 monoclonal antibody (M01), clone 2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged YSK4 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to YSK4 on HeLa cell . [antibody concentration 40 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant YSK4.
Immunogen
YSK4 (AAH34417, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged YSK4 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to YSK4 on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — YSK4
Entrez GeneID
80122GeneBank Accession#
BC034417Protein Accession#
AAH34417Gene Name
YSK4
Gene Alias
FLJ23074, RCK
Gene Description
YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae)
Gene Ontology
HyperlinkOther Designations
Yeast Sps1/Ste20-related kinase 4|regulated in COPD kinase|yeast Sps1/Ste20-related kinase 4
-
Publication Reference
-
Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.
Arai M, Kawachi T, Kotoku N, Nakata C, Kamada H, Tsunoda S, Tsutsumi Y, Endo H, Inoue M, Sato H, Kobayashi M.
ChemBioChem 2016 Jan; 17(2):181.
-
Furospinosulin-1, marine spongean furanosesterterpene, suppresses the growth of hypoxia-adapted cancer cells by binding to transcriptional regulators p54nrb and LEDGF/p75.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com