Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGAP1 polyclonal antibody (A01)

  • Catalog # : H00080055-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PGAP1.
  • Immunogen:
  • PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080055-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PGAP1
  • Gene Alias:
  • Bst1,FLJ42774,ISPD3024
  • Gene Description:
  • post-GPI attachment to proteins 1
  • Gene Summary:
  • PGAP1 catalyzes the inositol deacylation of glycosylphosphatidylinositol (GPI) at an early step in GPI biosynthesis. Inositol deacylation is essential for the generation of mature GPI capable of attachment to proteins (Tanaka et al., 2004 [PubMed 14734546]).[supplied by OMIM
  • Other Designations:
  • GPI deacylase,GPI inositol-deacylase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook