FBXL18 monoclonal antibody (M01), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXL18.
Immunogen
FBXL18 (NP_079239, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (72)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBXL18 monoclonal antibody (M01), clone 3H5 Western Blot analysis of FBXL18 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FBXL18 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBXL18 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FBXL18
Entrez GeneID
80028GeneBank Accession#
NM_024963Protein Accession#
NP_079239Gene Name
FBXL18
Gene Alias
FLJ10776, FLJ11467, FLJ26934, FLJ38075, FLJ41541, Fbl18
Gene Description
F-box and leucine-rich repeat protein 18
Omim ID
609084Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXL18, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com