PANK2 monoclonal antibody (M01), clone 2B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1 ~ 10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PANK2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.16 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PANK2.
Immunogen
PANK2 (NP_705902, 205 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.16 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1 ~ 10 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PANK2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PANK2
Entrez GeneID
80025GeneBank Accession#
NM_153638Protein Accession#
NP_705902Gene Name
PANK2
Gene Alias
C20orf48, FLJ17232, HARP, HSS, MGC15053, NBIA1, PKAN
Gene Description
pantothenate kinase 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq
Other Designations
Hallervorden-Spatz syndrome|OTTHUMP00000030143|OTTHUMP00000030148|pantothenic acid kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com